LL-37 Research Profile: Investigating Cathelicidin-Mediated Membrane Permeabilization

LL-37 ( $[LL-37, 37 aa]$ ) represents the linear, amphipathic alpha-helical C-terminal fragment of the human cathelicidin antimicrobial peptide (hCAP18). In 2026 life sciences research, this 37-amino acid biomolecule serves as a foundational model for examining innate immune signaling, cytokine-independent inflammation modulation, and the physical disruption of anionic lipid bilayers. Institutions choosing to buy LL-37 online trust Peptide Crafters for analytical transparency and batch-specific lab reports.

Molecular Specifications

Parameter	Specification
Amino Acid Sequence	$[LL-37, 37 aa]$
Molecular Formula	$C_{205}H_{340}N_{60}O_{53}$
Molecular Weight	$4493.3\ g/mol$
CAS Number	154947-66-7
Structure	Synthetic amphipathic linear alpha-helical polypeptide (Acetate Salt)
Purity Grade	99%+ Analytical Standard

Pharmacokinetic Horizons

Multimodal Ligand-Receptor Affinity and Lipopolysaccharide Inactivation: LL-37 is heavily utilized for Analyzing the binding affinity at the formyl peptide receptor-like 1 (FPRL1/FPR2) complex and the purinergic P2X7 receptor, tracking how its highly cationic sequence neutralizes bacterial lipopolysaccharides (LPS) to obstruct downstream endotoxin signaling cascades.
Structural Self-Association and Proteolytic Mitigation: The peptide exhibits a unique propensity to self-associate into oligomers under physiological salt concentrations, a biochemical trait that provides intrinsic Proteolytic Mitigation against rapid breakdown by host serine proteases, ensuring sustained baseline structural integrity during long-term incubation assays.
Pro-Inflammatory and Angiogenic Cellular Transduction Flux: Studies focus on the peptide’s secondary Cellular Transduction cascades, specifically mapping the transactivation of the epidermal growth factor receptor (EGFR) and the subsequent upregulation of mitogen-activated protein kinase (MAPK) pathways responsible for modeling angiogenesis and cell migration.

Why Procure from Peptide Crafters?

ISO-Certified HPLC Identification: Every sequential production lot from this peptide crafter undergoes thorough high-performance liquid chromatography and mass spectrometry profiling to establish absolute sequence integrity and structural purity.
60-Day Money-Back Quality Guarantee: We provide an uncompromising 60-day replacement window, a robust quality assurance baseline that forms the foundation of positive peptide crafters reviews across global life science institutions.
Vacuum-Sealed Lyophilized Preservation: Reagents undergo state-of-the-art flash freezing and deep moisture extraction to maximize molecular shelf-life, ensuring pristine stability when you buy peptides online.
Strict Institutional Security: While procurement teams routinely implement a peptide crafters coupon code or a peptide crafters discount code to optimize laboratory allocations, the foundational value rests on our strict adherence to USP 71/85 sterilization and endotoxin criteria.

For comprehensive sequence packages and automated bulk logistics, navigate to the official peptide crafters catalog portal. Entering an active peptide crafters coupon code during checkout enables purchasing teams to obtain clinical-grade compounds while maintaining precise alignment with expected financial boundaries, supported by industry-best peptide crafters reviews.

Research Use Only: All Peptide Crafters products are strictly for in-vitro laboratory research. Not for human or veterinary use. Communication regarding bodily administration will result in an immediate account termination.